Name :
Cd276 (Mouse) Recombinant Protein
Biological Activity :
Mouse Cd276 (Q8VE98, 29 a.a. – 248 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag :
Protein Accession No. :
Q8VE98
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=102657
Amino Acid Sequence :
VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFPPEAHHHHHH
Molecular Weight :
24.7
Storage and Stability :
Store at 2°C to 8°C for 2-4 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
insect
Interspecies Antigen Sequence :
Preparation Method :
Sf9 cell expression system
Purification :
Quality Control Testing :
Storage Buffer :
In PBS pH 7.4 (10% glycerol)
Applications :
SDS-PAGE，
Gene Name :
Cd276
Gene Alias :
6030411F23Rik, AU016588, B7RP-2, B7h3
Gene Description :
CD276 antigen
Gene Summary :
Other Designations :
B7 homlog 3|B7-H3
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD4 web
IL-11 MedChemExpress
Popular categories:
SHP-2
DAF Protein/CD55
