Share this post on:

Name :
Clcf1 (Mouse) Recombinant Protein

Biological Activity :
Mouse Clcf1 (P51642) recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :

Protein Accession No. :
P51642

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=56708

Amino Acid Sequence :
MAFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM.

Molecular Weight :
22.6

Storage and Stability :
Store at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :

Storage Buffer :
Lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.4.

Applications :
Functional Study, SDS-PAGE,

Gene Name :
Clcf1

Gene Alias :
Bsf3, CLC, MGC129162, MGC129163

Gene Description :
cardiotrophin-like cytokine factor 1

Gene Summary :

Other Designations :
B-cell stimulating factor 3|NNT-1/BSF-3|neurotrophin-1/B-cell stimulating factor-3

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-1 alpha ProteinFormulation
Dkk-1 Proteinweb
Popular categories:
TRIM/RBCC Proteins
VCAM-1/CD106

Share this post on:

Author: PIKFYVE- pikfyve