Name :
IL1B (Human) Recombinant Protein
Biological Activity :
Human IL1B recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.
Tag :
Result of activity analysis
Protein Accession No. :
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3553
Amino Acid Sequence :
MASAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS with polyhistidine tag at the C-terminus.
Molecular Weight :
Storage and Stability :
Lyophilized protein should be stored at -20°C. Protein aliquots should be stored at-20°C to -80°C. This product is stable for one year. Avoid repeated freeze/thaw cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Ni-NTA chromatography
Quality Control Testing :
SDS-PAGE Stained with Coomassie Blue. SDS-PAGE analysis of IL1B (Human) Recombinant Protein.
Storage Buffer :
Lyophilized from a solution containing 1X PBS, pH 8.0. Reconstitute the lyophilized powder in ddH2O to a concentration not less than 100 ug/mL.
Applications :
Functional Study， SDS-PAGE，
Gene Name :
IL1B
Gene Alias :
IL-1, IL1-BETA, IL1F2
Gene Description :
interleukin 1, beta
Gene Summary :
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq
Other Designations :
catabolin|preinterleukin 1 beta|pro-interleukin-1-beta
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Protein tyrosine phosphatases Recombinant Proteins
Activin/Inhibins MedChemExpress
Popular categories:
Adenosine Receptor
Cystatin A
