Name :
CISD1 (Human) Recombinant Protein
Biological Activity :
Human CISD1 (NP_060934, 32 a.a. – 108 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Tag :
Protein Accession No. :
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=55847
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Molecular Weight :
11.4
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer :
In 20 mM Tris-HCl buffer, 0.15 M NaCl, pH 8.0 (10% glycerol, 1 mM DTT).
Applications :
SDS-PAGE,
Gene Name :
CISD1
Gene Alias :
C10orf70, MDS029, MGC14684, ZCD1, mitoNEET
Gene Description :
CDGSH iron sulfur domain 1
Gene Summary :
CISD1 is a member of the CDGSH domain-containing family and may play a role in the regulation of mitochondrial oxidative capacity (Wiley et al., 2007, 2007 [PubMed 17376863] [PubMed 17584744]).[supplied by OMIM
Other Designations :
OTTHUMP00000019629|zinc finger CDGSH-type domain 1|zinc finger, CDGSH-type domain 1
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cystatin Family MedChemExpress
CD19 Recombinant Proteins
Popular categories:
ADAM18
Complement Receptor 2
